- Protein: Peroxidase
- Organism: Lactobacillus fermentum (Limosilactobacillus fermentum)
- Length: 313
- Sequence:
MSVNPQRSQDVYRDAGKNVLFLMLSLNRQDQTNEKAAVEETADRLQAIKRSLNVRYPDSHLRIACGISSKAWDYLFPQAPKPKELEDFTGIKGDKYDAPGTPADLFFHVRADDQSLTYEVIDEIMTFLRPVTKVVDETHGFRYFEGRAIIGFVDGTENPVDADAVEWGIIHEEDPEFENGSYAFAQKYLHQMDAWKSLSTEQQEQVIGRRKFTDLEQGDEDKNQRAHNVVSQDNRNDVEHKIIRMNVPFSDPGENVTGTYFIGYGRYWDVTKTMLTNMFTKNDLLLDYSTPVNGQVFFIPSIDTLDKIADDEY
| Resolution | 1.83 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-313 (1-313), 1.00 |
| auth_asym_id | A |
| Nonstandard amino acids | MSE |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Resolution | 1.83 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-313 (1-313), 1.00 |
| auth_asym_id | B |
| Nonstandard amino acids | MSE |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |