Danish
Uniprot ID:  A0A0G9GI91
  • Protein: Peroxidase
  • Organism: Lactobacillus fermentum (Limosilactobacillus fermentum)
  • Length: 313
  • Sequence:
    • MSVNPQRSQDVYRDAGKNVLFLMLSLNRQDQTNEKAAVEETADRLQAIKRSLNVRYPDSHLRIACGISSKAWDYLFPQAPKPKELEDFTGIKGDKYDAPGTPADLFFHVRADDQSLTYEVIDEIMTFLRPVTKVVDETHGFRYFEGRAIIGFVDGTENPVDADAVEWGIIHEEDPEFENGSYAFAQKYLHQMDAWKSLSTEQQEQVIGRRKFTDLEQGDEDKNQRAHNVVSQDNRNDVEHKIIRMNVPFSDPGENVTGTYFIGYGRYWDVTKTMLTNMFTKNDLLLDYSTPVNGQVFFIPSIDTLDKIADDEY
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007ylo , Chain A 
Resolution 1.83 Å
Residue indices (Uniprot), coverage 3-313 (1-313), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 23MET-23MET:125MET-125MET:192MET-192MET:245MET-245MET:274MET-274MET:278MET-278MET
Nonstandard amino acids MSE Structure of MSEMSE
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007ylo , Chain B 
Resolution 1.83 Å
Residue indices (Uniprot), coverage 3-313 (1-313), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 23MET-23MET:125MET-125MET:192MET-192MET:245MET-245MET:274MET-274MET:278MET-278MET
Nonstandard amino acids MSE Structure of MSEMSE
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å