Danish

Uniprot ID: A0A1C8XRP4

Protein: Cytochrome b559 subunit beta
Organism: Green alga (Dunaliella salina)
Length: 44
Sequence:

MTTRKSAEAITYPIFTVRWLAIHAIAVPTIFFLGAITAMQFIQR

Number of chains: 8

PDB ID: 7pi5 , Chain FA
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
auth_asym_id	f
label_asym_ids of heme	HK
Available structure	PDB

PDB ID: 7pi5 , Chain G
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	SD
Available structure	PDB

PDB ID: 7pin , Chain DC
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
auth_asym_id	f1
label_asym_ids of heme	OAA
Available structure	PDB

PDB ID: 7pin , Chain EB
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
auth_asym_id	F1
label_asym_ids of heme	PT
Available structure	PDB

PDB ID: 7pin , Chain FA
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
auth_asym_id	f
label_asym_ids of heme	RM
Available structure	PDB

PDB ID: 7pin , Chain G
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	SF
Available structure	PDB

PDB ID: 7pnk , Chain EA
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
auth_asym_id	f
label_asym_ids of heme	YJ
Available structure	PDB

PDB ID: 7pnk , Chain G
Residue indices (Uniprot), coverage	14-44 (14-44), 0.70
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	OD
Available structure	PDB