- Protein: Cytochrome b-c1 complex catalytic subunit, mitochondrial
- Organism: Yeast (Candida albicans (strain SC5314 / ATCC MYA-2876))
- Length: 288
- Sequence:
MFRTAYKTMNQSMVQKFIAGGVGVTGLTASYLLYQDSMTADAMTAAEHGLHPPAYNWPHNGMFETFDHASIRRGFQVYREVCAACHSLDRIAWRNLVGVSHTTSEAKAMAEELEYDDEPDDEGKPRKRPGKLADYIPGPYENEQAARAANQGAYPPDLSLIVKARHGGSDYIFSLLTGYPDEPPAGVVLPEGSNYNPYFPGGAIAMGRVLFDDLVEYEDGTPATTSQMAKDVSTFLNWASEPEHDDRKKWGLKALVVLSSLYLLSIWVKRFKWTPIKNRKFRFDPPKK
| Residue indices (Uniprot), coverage | 43-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | W |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 43-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | N |
| label_asym_ids of heme | CA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 43-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 43-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 43-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | P |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 44-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | Y |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 44-286 (1-288), 1.00 |
|---|---|
| auth_asym_id | N |
| label_asym_ids of heme | Z |
| Available structure | PDB |