- Protein: Cloroperoxidase
- Organism:
- Length: 261
- Sequence:
MKSLSFSLALGFGSTLVYSAPSPSSGWQAPGPNDVRAPCPMLNTLANHGFLPHDGKGITVNKTIDALGSALNIDANLSTLLFGFAATTNPQPNATFFDLDHLSRHNILEHDASLSRQDSYFGPADVFNEAVFNQTKSFWTGDIIDVQMAANARIVRLLTSNLTNPEYSLSDLGSAFSIGESAAYIGILGDKKSATVPKSWVEYLFENERLPYELGFKRPNDPFTTDDLGDLSTQIINAQHFPQSPGKVEKRGDTRCPYGYH
| Resolution | 1.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-251 (1-261), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-262 (1-261), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | D |
| Available structure | PDB (not modeled) |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-249 (1-261), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 25-251 (1-261), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.68 Å |
|---|---|
| Residue indices (Uniprot), coverage | 24-251 (1-261), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |