Danish

Uniprot ID: A0A380DQV1

Protein: Cytochrome P450 protein
Organism:
Length: 261
Sequence:

MDLLGINLENYEKIREWHNGIAKFITSFNLNDEEIKYSLECSDKLENYLMPLIKDRKKSTKDDLISILLEYKNDENSISDTEILALSLNVLLAATEPVDKTLAYLFYNLLKNPEQFESVKNNPKLIKNAIIETLRYNSPVQLIPRQVSKPFIFNNTELQAGDTVICMIGSANRDPEAYSNPDEFNIHRSSDNKSPFTSHSQNLSFGTGVHTCVGASFSLIQLEMVAILLLKRLKNIKLKTMEITEHGIYTRGPKSMVISFD

Number of chains: 7

PDB ID: 7ow9 , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	3-399 (1-261), 1.00
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 8a91 , Chain A
Resolution	1.85 Å
Residue indices (Uniprot), coverage	3-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	B
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 8a8l , Chain A
Resolution	1.88 Å
Residue indices (Uniprot), coverage	2-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	B
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 8aa7 , Chain A
Resolution	2.05 Å
Residue indices (Uniprot), coverage	2-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7pq1 , Chain A
Resolution	2.46 Å
Residue indices (Uniprot), coverage	2-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	B
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 8adr , Chain A
Residue indices (Uniprot), coverage	3-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 8ae8 , Chain A
Residue indices (Uniprot), coverage	3-399 (1-261), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	B
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å