Danish

Uniprot ID: A0A679C209

Protein: Cytochrome b559 subunit alpha
Organism:
Length: 84
Sequence:

MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFTQDRQQVPLVNDRFSAKQELEDLTKGL

Number of chains: 4

PDB ID: 7vd5 , Chain BA
Residue indices (Uniprot), coverage	9-83 (9-83), 0.89
auth_asym_id	e
label_asym_ids of heme	EH
Available structure	PDB

PDB ID: 7vd5 , Chain E
Residue indices (Uniprot), coverage	9-83 (9-83), 0.89
auth_asym_id	E
label_asym_ids of heme	EE
Available structure	PDB

PDB ID: 8j5k , Chain AA
Residue indices (Uniprot), coverage	8-82 (9-83), 0.89
auth_asym_id	e
label_asym_ids of heme	XG
Available structure	PDB

PDB ID: 8j5k , Chain E
Residue indices (Uniprot), coverage	8-82 (9-83), 0.89
auth_asym_id	E
label_asym_ids of heme	VD
Available structure	PDB