Danish
Uniprot ID:  A0A679C209
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Chaetoceros neogracilis
  • Length: 84
  • Sequence:
    • MSGGSTGERPFSDIITSVRYWIIHSITIPSLFVSGWLFISTGLAYDVFGTPRPNEYFTQDRQQVPLVNDRFSAKQELEDLTKGL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007vd5 , Chain BA 
Residue indices (Uniprot), coverage 9-83 (9-83), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E8, L84
Sequence identity to UniProt 1.0000
auth_asym_id e
label_asym_ids of heme EH
Available structure PDB
PDB ID:  pdb_00007vd5 , Chain E 
Residue indices (Uniprot), coverage 9-83 (9-83), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E8, L84
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme EE
Available structure PDB