Danish

Uniprot ID: A0R050

Protein: Cytochrome bc1 complex cytochrome c subunit
Organism: Mycobacterium smegmatis (Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155))
Length: 268
Sequence:

MTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMWIIGMVAAIGVAMWIGSRA

Number of chains: 6

PDB ID: 6hwh , Chain AA
Residue indices (Uniprot), coverage	47-229 (1-268), 1.00
auth_asym_id	i
Structural gaps	Exists
label_asym_ids of heme	FB
Available structure	PDB (not modeled)

PDB ID: 6hwh , Chain BA
Residue indices (Uniprot), coverage	47-229 (1-268), 1.00
auth_asym_id	j
Structural gaps	Exists
label_asym_ids of heme	GB , HB
Available structure	PDB (not modeled)

PDB ID: 6hwh , Chain F
Residue indices (Uniprot), coverage	239-268 (1-268), 1.00
auth_asym_id	M
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6hwh , Chain S
Residue indices (Uniprot), coverage	239-268 (1-268), 1.00
auth_asym_id	K
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6hwh , Chain F
Residue indices (Uniprot), coverage	239-268 (1-268), 1.00
auth_asym_id	M
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6hwh , Chain S
Residue indices (Uniprot), coverage	239-268 (1-268), 1.00
auth_asym_id	K
label_asym_ids of heme	None
Available structure	PDB