Danish

Uniprot ID: A0R057

Protein: cytochrome-c oxidase
Organism: Mycobacterium smegmatis (Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155))
Length: 341
Sequence:

MTPRGFRVVALSIVLGGSALLLSGCSWSDALALGWPTGITPEAKLNRELWIGSVIASFAVGAIVWGLIFWTSAFHRKKATDTELPRQFGYNMPLELTLTVIPFLIISVLFYFTVVVQERMMHKDPNPEVVIDVTAFQWNWKFGYQKIAFADGSFDYDGADPERKEAMTSRPEGKDEHGIEKVGPIRGMTPEDRTYLNFDKIETLGTSSEIPVLVLPAGKRIEFVLNSADVIHGFWVPEFLFKRDVLPEPKANNSDNVFQVSEIQQTGAFVGRCTEMCGTFHAMMNFEVRVVEPNDFKAYIDQRNAGKTNAEALAAINQPPLAITTEPFESRRGELVPQASK

Number of chains: 18

PDB ID: 7e1v , Chain A
Resolution	2.68 Å
Residue indices (Uniprot), coverage	27-331 (1-341), 1.00
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 7e1v , Chain H
Resolution	2.68 Å
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 7e1x , Chain A
Resolution	2.93 Å
Residue indices (Uniprot), coverage	27-331 (1-341), 1.00
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 7e1x , Chain H
Resolution	2.93 Å
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 6adq , Chain A
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	E
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6adq , Chain M
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	Q
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6hwh , Chain G
Residue indices (Uniprot), coverage	28-333 (1-341), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 6hwh , Chain T
Residue indices (Uniprot), coverage	28-333 (1-341), 1.00
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	HB
Available structure	PDB (not modeled)

PDB ID: 6hwh , Chain G
Residue indices (Uniprot), coverage	28-333 (1-341), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 6hwh , Chain T
Residue indices (Uniprot), coverage	28-333 (1-341), 1.00
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	HB
Available structure	PDB (not modeled)

PDB ID: 7e1w , Chain A
Residue indices (Uniprot), coverage	27-331 (1-341), 1.00
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 7e1w , Chain H
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB (not modeled)

PDB ID: 7rh5 , Chain G
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	Q
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7rh5 , Chain N
Residue indices (Uniprot), coverage	27-338 (1-341), 1.00
auth_asym_id	K
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7rh6 , Chain K
Residue indices (Uniprot), coverage	27-338 (27-338), 0.91
auth_asym_id	Q
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7rh6 , Chain P
Residue indices (Uniprot), coverage	27-338 (27-338), 0.91
auth_asym_id	K
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7rh7 , Chain B
Residue indices (Uniprot), coverage	27-338 (27-338), 0.91
auth_asym_id	Q
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 7rh7 , Chain L
Residue indices (Uniprot), coverage	27-338 (27-338), 0.91
auth_asym_id	K
label_asym_ids of heme	None
Available structure	PDB