Danish

Uniprot ID: A9DF82

Protein: Group 1 truncated hemoglobin
Organism:
Length: 117
Sequence:

MSLYERLGGEQKIARIAADIFDTHATNPTVASRYKDSDRERVIKMVTEFLCAGTGGPQDYTGKSMPEAHRCMNINEAEYLAVIDDIMVALDKNEVGDQEKQELLMIAYSLKGEIIGA

Number of chains: 22

PDB ID: 7tt9 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 7tt9 , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 7tt9 , Chain C
Resolution	2.00 Å
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 7tt9 , Chain D
Resolution	2.00 Å
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 8tls , Chain A
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 8tls , Chain B
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 8ugz , Chain A
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 8ugz , Chain B
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 8ugz , Chain C
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 8ugz , Chain D
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 8uzu , Chain A
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 8uzu , Chain B
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 8uzu , Chain C
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 8uzu , Chain D
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 8vij , Chain A
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 8vij , Chain B
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 8vij , Chain C
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 8vij , Chain D
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 8w3a , Chain A
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 8w3a , Chain B
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 8w3a , Chain C
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 8w3a , Chain D
Residue indices (Uniprot), coverage	2-117 (2-117), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB