- Protein: Photosystem II extrinsic protein V
- Organism:
- Length: 163
- Sequence:
MLKKYSKFCALIFVGIFNIFITTAFAIDLDEATRTVVVDNAGNTTVLTPEQVKRGKRLFNATCGACHVGGITKTNPNVGLDPEALSLATPRRDNISALVDYIKNPTTYDGLESIAEVHPSIKSADIYPRMRSLTDEDLYSIAGHIMLSPKIASEKWGGGKIYY
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | v |
| label_asym_ids of heme | VG |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | V |
| label_asym_ids of heme | XD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | v |
| label_asym_ids of heme | EH |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | V |
| label_asym_ids of heme | BE |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | v |
| label_asym_ids of heme | RH |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | V |
| label_asym_ids of heme | ME |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-137 (27-163), 0.84 |
|---|---|
| auth_asym_id | v |
| label_asym_ids of heme | CJ |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-137 (27-163), 0.84 |
|---|---|
| Difference from Uniprot sequence | conflict |
| auth_asym_id | V |
| label_asym_ids of heme | GF |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (28-163), 0.83 |
|---|---|
| auth_asym_id | v |
| label_asym_ids of heme | JH |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-137 (28-163), 0.83 |
|---|---|
| auth_asym_id | V |
| label_asym_ids of heme | LE |
| Available structure | PDB |