Danish
Uniprot ID:  B9W4V6
  • Protein: Aromatic peroxygenase
  • Organism: Black poplar mushroom (Cyclocybe aegerita)
  • Length: 371
  • Sequence:
    • MKYFPLFPTLVFAARVVAFPAYASLAGLSQQELDAIIPTLEAREPGLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPVQIINAVQEGLNFDNQAAVFATYAAHLVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDYSNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVIQAHPMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFFFQGVAAGCTQVFPYGRD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  29
PDB ID:  pdb_00006ekz , Chain A 
Resolution 1.08 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006ekx , Chain A 
Resolution 1.13 Å
Residue indices (Uniprot), coverage 4-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006eky , Chain A 
Resolution 1.23 Å
Residue indices (Uniprot), coverage 4-327 (44-371), 0.88
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00009j1q , Chain A 
Resolution 1.34 Å
Residue indices (Uniprot), coverage 4-326 (47-369), 0.87
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-G46, R370-D371
Sequence identity to UniProt 0.9845
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00005oy2 , Chain A 
Resolution 1.36 Å
Residue indices (Uniprot), coverage 1-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00009j1x , Chain A 
Resolution 1.39 Å
Residue indices (Uniprot), coverage 2-326 (45-369), 0.88
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) V100A, L110F, V118I, G238A, G284V, I291V, F354L, G361V
Insertions None
Deletions M1-E44, R370-D371
Sequence identity to UniProt 0.9754
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00005oxt , Chain A 
Resolution 1.42 Å
Residue indices (Uniprot), coverage 1-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00005oxt , Chain B 
Resolution 1.42 Å
Residue indices (Uniprot), coverage 1-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id B
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00005oxt , Chain C 
Resolution 1.42 Å
Residue indices (Uniprot), coverage 1-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id C
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00005oy1 , Chain A 
Resolution 1.43 Å
Residue indices (Uniprot), coverage 2-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006ekw , Chain A 
Resolution 1.43 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005oxu , Chain A 
Resolution 1.47 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007pn6 , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00007pn8 , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006el4 , Chain A 
Resolution 1.53 Å
Residue indices (Uniprot), coverage 2-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00009jlh , Chain A 
Resolution 1.61 Å
Residue indices (Uniprot), coverage 1-326 (44-371), 0.88
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) V100A, L110F, Q115K, V118I, G238A, G284V, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9756
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008av5 , Chain A 
Resolution 1.62 Å
Residue indices (Uniprot), coverage 4-327 (47-370), 0.87
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-G46, D371
Sequence identity to UniProt 0.9846
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006el0 , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 4-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9848
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007pn7 , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007pn5 , Chain A 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007pn9 , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007pna , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007pn4 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 3-327 (44-371), 0.88
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V100A, L110F, V118I, A120L, I291V, F354L
Insertions None
Deletions M1-R43
Sequence identity to UniProt 0.9817
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002yor , Chain A 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 5-328 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002yor , Chain B 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 4-327 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00002yp1 , Chain A 
Resolution 2.31 Å
Residue indices (Uniprot), coverage 4-326 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00002yp1 , Chain B 
Resolution 2.31 Å
Residue indices (Uniprot), coverage 4-327 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme BA
Available structure PDB
PDB ID:  pdb_00002yp1 , Chain C 
Resolution 2.31 Å
Residue indices (Uniprot), coverage 4-328 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme HA
Available structure PDB
PDB ID:  pdb_00002yp1 , Chain D 
Resolution 2.31 Å
Residue indices (Uniprot), coverage 4-326 (47-371), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G46
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme QA
Available structure PDB