- Protein: Cytochrome b559 subunit beta
- Organism: Green alga (Dunaliella salina)
- Length: 44
- Sequence:
MTTRKSAEAVTYPIFTVRWLAIHAIAVPTIFFLGAITAMQFIQR
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | QK |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | VD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | f1 |
| label_asym_ids of heme | WZ |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | F1 |
| label_asym_ids of heme | XS |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | EM |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 14-44 (14-44), 0.70 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | PF |
| Available structure | PDB |