Danish

Uniprot ID: D0MGT2

Protein: Nitric oxide dioxygenase
Organism: Rhodothermus obamensis (Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10))
Length: 145
Sequence:

MAPTLSEQTRQLVRASVPALQKHSVAISATMYRLLFERYPETRSLFELPERQIHKLASALLAYARSIDNPSALQAAIRRMVLSHARAGVQAVHYPLVWECLRDAIKEVLGPDATETLLQAWKEAYDFLAHLLSTKEAQVYAVLAE

Number of chains: 4

PDB ID: 6wk3 , Chain A
Resolution	2.45 Å
Residue indices (Uniprot), coverage	1-145 (1-145), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 6wk3 , Chain B
Resolution	2.45 Å
Residue indices (Uniprot), coverage	4-145 (1-145), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 6wk3 , Chain C
Resolution	2.45 Å
Residue indices (Uniprot), coverage	1-145 (1-145), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	C
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 6wk3 , Chain D
Resolution	2.45 Å
Residue indices (Uniprot), coverage	0-145 (1-145), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	D
label_asym_ids of heme	P
Available structure	PDB