Danish
Uniprot ID:  D0MGT2
  • Protein: Nitric oxide dioxygenase
  • Organism: Rhodothermus obamensis (Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10))
  • Length: 145
  • Sequence:
    • MAPTLSEQTRQLVRASVPALQKHSVAISATMYRLLFERYPETRSLFELPERQIHKLASALLAYARSIDNPSALQAAIRRMVLSHARAGVQAVHYPLVWECLRDAIKEVLGPDATETLLQAWKEAYDFLAHLLSTKEAQVYAVLAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00006wk3 , Chain A 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 1-145 (1-145), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q52V
Insertions 0insS
Deletions None
Sequence identity to UniProt 0.9931
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006wk3 , Chain B 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 4-145 (1-145), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q52V
Insertions 0insS
Deletions None
Sequence identity to UniProt 0.9931
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006wk3 , Chain C 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 1-145 (1-145), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q52V
Insertions 0insS
Deletions None
Sequence identity to UniProt 0.9931
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006wk3 , Chain D 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 0-145 (1-145), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Q52V
Insertions 0insS
Deletions None
Sequence identity to UniProt 0.9931
auth_asym_id D
label_asym_ids of heme P
Available structure PDB