- Protein: Dyp-type peroxidase family
- Organism:
- Length: 403
- Sequence:
MAPSQRPLSRRGLLAGGAIAAAAGALAACSEERAAGARPSATQTTGTATEPFHGPHQAGIATPPQAHAVFLGLDLRKGTGRKELGRLMRLLTDDARRLTQGRPALADPEPDLAPLPSRLTFTFGFGPGLFKAAGLEKQRPEGLRPLPPFKVDRLEDRWSGGDLLVQICCDDPITLAHALRMTVKDARAFTRVRWVQRGFRRSPGVQSSGATQRNLMGQLDGTVNPVPGTADFDQAVWVQDGPEWLRGGTTLVLRRIRMELEKWDEADPAGKEFAVGRRLTSGAPLTGRHEHDEPDFDAVDSAGFPVIAENAHIRLAHVDSPRLRMLRRPYNYDEGLTADGRSDAGLLFAAYQADIDRQFIPVQRRLDEGGDLLNLWTTPIGSAVFAIPPGCDENGWIGQGLLG
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 44-403 (31-403), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 44-403 (31-403), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 43-403 (31-403), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Nonstandard amino acids | MHS |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 43-403 (31-403), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Nonstandard amino acids | MHS |
| label_asym_ids of heme | B-1 |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Residue indices (Uniprot), coverage | 44-403 (31-403), 0.93 |
|---|---|
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 43-403 (31-403), 0.93 |
|---|---|
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 44-403 (31-403), 0.93 |
|---|---|
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 44-403 (31-403), 0.93 |
|---|---|
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |