Danish
Uniprot ID:  D1A807
  • Protein: Dyp-type peroxidase family
  • Organism: Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / KCTC 9072 / NBRC 15933 / NCIMB 10081 / Henssen B9)
  • Length: 403
  • Sequence:
    • MAPSQRPLSRRGLLAGGAIAAAAGALAACSEERAAGARPSATQTTGTATEPFHGPHQAGIATPPQAHAVFLGLDLRKGTGRKELGRLMRLLTDDARRLTQGRPALADPEPDLAPLPSRLTFTFGFGPGLFKAAGLEKQRPEGLRPLPPFKVDRLEDRWSGGDLLVQICCDDPITLAHALRMTVKDARAFTRVRWVQRGFRRSPGVQSSGATQRNLMGQLDGTVNPVPGTADFDQAVWVQDGPEWLRGGTTLVLRRIRMELEKWDEADPAGKEFAVGRRLTSGAPLTGRHEHDEPDFDAVDSAGFPVIAENAHIRLAHVDSPRLRMLRRPYNYDEGLTADGRSDAGLLFAAYQADIDRQFIPVQRRLDEGGDLLNLWTTPIGSAVFAIPPGCDENGWIGQGLLG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00008fjr , Chain A 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 44-403 (31-403), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A, E293H
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9421
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008fjr , Chain B 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 44-403 (31-403), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A, E293H
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9421
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00008fjq , Chain A 
Resolution 1.62 Å
Residue indices (Uniprot), coverage 44-403 (31-403), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A, E293G
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9421
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008fjq , Chain B 
Resolution 1.62 Å
Residue indices (Uniprot), coverage 43-403 (31-403), 0.99
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A, E293G
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9421
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00005jxu , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 44-403 (31-403), 0.99
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9446
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005jxu , Chain B 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 44-403 (31-403), 0.99
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9446
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00007rmu , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 43-403 (31-403), 0.99
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9446
auth_asym_id A
Missing residues 312HIS-312HIS
Nonstandard amino acids MHS Structure of MHSMHS
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007rmu , Chain A-1 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 43-403 (31-403), 0.99
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A2H, P3H, S4H, Q5H, R6H, P7H, L8S, S9T, R10S, R11V, G12D, A20G, A21T, A22E, A23N, G24L, A25Y, L26F, A27Q, A28S, C29N, S30A
Insertions None
Deletions L14-I19
Sequence identity to UniProt 0.9446
auth_asym_id A
Missing residues 312HIS-312HIS
Nonstandard amino acids MHS Structure of MHSMHS
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å