Danish

Uniprot ID: D5ANZ3

Protein: Cytochrome b
Organism:
Length: 437
Sequence:

MSGIPHDHYEPKTGIEKWLHDRLPIVGLVYDTIMIPTPKNLNWWWIWGIVLAFTLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRDVNGGWAMRYIHANGASLFFLAVYIHIFRGLYYGSYKAPREITWIVGMVIYLLMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGIGPSIQAWLLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHTTGNNNPTGVEVRRTSKADAEKDTLPFWPYFVIKDLFALALVLLGFFAVVAYMPNYLGHPDNYVQANPLSTPAHIVPEWYFLPFYAILRAFAADVWVVILVDGLTFGIVDAKFFGVIAMFGAIAVMALAPWLDTSKVRSGAYRPKFRMWFWFLVLDFVVLTWVGAMPTEYPYDWISLIASTYWFAYFLVILPLLGATEKPEPIPASIEEDFNSHYGNPAE

Number of chains: 14

PDB ID: 6xi0 , Chain B
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	H , I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6xi0 , Chain D
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	K , L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xkt , Chain A
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	G , H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xkt , Chain C
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	J , K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xku , Chain C
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	I , J
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xku , Chain E
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	L , M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6xkv , Chain A
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	G , H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xkv , Chain C
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	J , K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6xkw , Chain G
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	S , T
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xkw , Chain I
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	V , W
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6xkx , Chain B
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	K , L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6xkx , Chain D
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	N , O
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6xkz , Chain B
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	K , L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å

PDB ID: 6xkz , Chain D
Residue indices (Uniprot), coverage	2-428 (1-437), 1.00
auth_asym_id	P
Structural gaps	Exists
label_asym_ids of heme	N , O
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.17 Å