Danish
Uniprot ID:  D5ANZ3
  • Protein: Cytochrome b
  • Organism: Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
  • Length: 437
  • Sequence:
    • MSGIPHDHYEPKTGIEKWLHDRLPIVGLVYDTIMIPTPKNLNWWWIWGIVLAFTLVLQIVTGIVLAMHYTPHVDLAFASVEHIMRDVNGGWAMRYIHANGASLFFLAVYIHIFRGLYYGSYKAPREITWIVGMVIYLLMMGTAFMGYVLPWGQMSFWGATVITGLFGAIPGIGPSIQAWLLGGPAVDNATLNRFFSLHYLLPFVIAALVAIHIWAFHTTGNNNPTGVEVRRTSKADAEKDTLPFWPYFVIKDLFALALVLLGFFAVVAYMPNYLGHPDNYVQANPLSTPAHIVPEWYFLPFYAILRAFAADVWVVILVDGLTFGIVDAKFFGVIAMFGAIAVMALAPWLDTSKVRSGAYRPKFRMWFWFLVLDFVVLTWVGAMPTEYPYDWISLIASTYWFAYFLVILPLLGATEKPEPIPASIEEDFNSHYGNPAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  26
PDB ID:  pdb_000029ye , Chain B 
Resolution 2.41 Å
Residue indices (Uniprot), coverage 2-433 (2-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029ye , Chain E 
Resolution 2.41 Å
Residue indices (Uniprot), coverage 2-433 (2-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme T ,  U
Available structure PDB
PDB ID:  pdb_000029yc , Chain B 
Resolution 2.43 Å
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029yc , Chain E 
Resolution 2.43 Å
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  S
Available structure PDB
PDB ID:  pdb_000029ya , Chain B 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029ya , Chain E 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  S
Available structure PDB
PDB ID:  pdb_000029xz , Chain B 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029xz , Chain E 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  S
Available structure PDB
PDB ID:  pdb_000029yb , Chain B 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029yb , Chain E 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  S
Available structure PDB
PDB ID:  pdb_000029yd , Chain B 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I ,  J
Available structure PDB
PDB ID:  pdb_000029yd , Chain E 
Residue indices (Uniprot), coverage 2-437 (2-437), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 437insWSHPQFEK
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme R ,  S
Available structure PDB
PDB ID:  pdb_00006xi0 , Chain B 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme I ,  H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xi0 , Chain D 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme L ,  K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xkt , Chain A 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme H ,  G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xkt , Chain C 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme K ,  J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006xku , Chain C 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme J ,  I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xku , Chain E 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme M ,  L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006xkv , Chain A 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme H ,  G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xkv , Chain C 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme K ,  J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006xkw , Chain G 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme T ,  S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xkw , Chain I 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme W ,  V
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006xkx , Chain B 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme L ,  K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00006xkx , Chain D 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme O ,  N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006xkz , Chain B 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme L ,  K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00006xkz , Chain D 
Residue indices (Uniprot), coverage 2-428 (1-437), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id P
Missing residues 233SER-236ASP
Structural gaps Exists
label_asym_ids of heme O ,  N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å