Danish

Uniprot ID: D5ANZ4

Protein: Cytochrome c1
Organism:
Length: 279
Sequence:

MKKLLISAVSALVLGSGAAFANSNVPDHAFSFEGIFGKYDQAQLRRGFQVYNEVCSACHGMKFVPIRTLADDGGPQLDPTFVREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQLFKGMGGPEYIYNYVIGFEENPECAPEGIDGYYYNKTFQIGGVPDTCKDAAGVKITHGSWARMPPPLVDDQVTYEDGTPATVDQMAQDVSAFLMWAAEPKLVARKQMGLVAMVMLGLLSVMLYLTNKRLWAPYKGHKA

Number of chains: 14

PDB ID: 6xi0 , Chain C
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	J
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	11.57 Å

PDB ID: 6xi0 , Chain E
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	12.71 Å

PDB ID: 6xkt , Chain B
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	11.27 Å

PDB ID: 6xkt , Chain D
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	12.44 Å

PDB ID: 6xku , Chain D
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	12.71 Å

PDB ID: 6xku , Chain F
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	11.26 Å

PDB ID: 6xkv , Chain B
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	12.15 Å

PDB ID: 6xkv , Chain D
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	12.15 Å

PDB ID: 6xkw , Chain H
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	U
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6xkw , Chain J
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	X
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	9.21 Å

PDB ID: 6xkx , Chain C
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	3.78 Å

PDB ID: 6xkx , Chain E
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	9.21 Å

PDB ID: 6xkz , Chain C
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	4.62 Å

PDB ID: 6xkz , Chain E
Residue indices (Uniprot), coverage	5-257 (1-279), 1.00
auth_asym_id	Q
Structural gaps	Exists
label_asym_ids of heme	P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	11.27 Å