Danish

Uniprot ID: D5DF35

Protein: Cytochrome P450
Organism: Bacillus megaterium (Priestia megaterium (strain DSM 319 / IMG 1521))
Length: 410
Sequence:

MNKEVIPVTEIPKFQSRAEEFFPIQWYKEMLNNSPVYFHEETNTWNVFQYEHVKQVLSDYEFFSSDGQRTTIFVGDNSKKKSTSPITNLTNLDPPDHRKARSLLAAAFTHRSLKNWEPRIKQIAADLVEAIQKNPTINIVDDLSSPFPSLVIADLFGVPVKDRYQFKKWVDILFQPYDQERLEEIEQEKQRAGAEYFQYLYPIVIEKRSNLSDDIISDLIQAEFDGETFTDEEIVHATMLLLGAGVETTSHAIANMFYSFLYDDKSLYSELRNNRELAPKAVEEMLRYRFHISRRDRTVKQDNELLGVKLKKGDVVIAWMSACNMDETMFENPFSVDIHRPTNKKHLTFGNGPHFCLGAPLARLEMKIILEAFLEAFSHIEPFEDFELEPHLTASATGQSLTYLPMTVYR

Number of chains: 8

PDB ID: 7q9e , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-411 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 7q9e , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	5-411 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.19 Å

PDB ID: 7q9e , Chain C
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-413 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	V
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 7q9e , Chain D
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-413 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	DA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7zzl , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-411 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 7zzl , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	5-411 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.19 Å

PDB ID: 7zzl , Chain C
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-413 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	V
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 7zzl , Chain D
Resolution	1.70 Å
Residue indices (Uniprot), coverage	4-413 (1-410), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	DA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å