Danish
Uniprot ID:  D5DF35
  • Protein: Cytochrome P450
  • Organism: Bacillus megaterium (Priestia megaterium (strain DSM 319 / IMG 1521))
  • Length: 410
  • Sequence:
    • MNKEVIPVTEIPKFQSRAEEFFPIQWYKEMLNNSPVYFHEETNTWNVFQYEHVKQVLSDYEFFSSDGQRTTIFVGDNSKKKSTSPITNLTNLDPPDHRKARSLLAAAFTHRSLKNWEPRIKQIAADLVEAIQKNPTINIVDDLSSPFPSLVIADLFGVPVKDRYQFKKWVDILFQPYDQERLEEIEQEKQRAGAEYFQYLYPIVIEKRSNLSDDIISDLIQAEFDGETFTDEEIVHATMLLLGAGVETTSHAIANMFYSFLYDDKSLYSELRNNRELAPKAVEEMLRYRFHISRRDRTVKQDNELLGVKLKKGDVVIAWMSACNMDETMFENPFSVDIHRPTNKKHLTFGNGPHFCLGAPLARLEMKIILEAFLEAFSHIEPFEDFELEPHLTASATGQSLTYLPMTVYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00007q9e , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-411 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 73PHE-85PRO:164TYR-165GLN:175GLN-186GLU
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007q9e , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 5-411 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 73PHE-86ILE:164TYR-165GLN:175GLN-182LEU
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.21 Å
PDB ID:  pdb_00007q9e , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-413 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 75GLY-87THR
Structural gaps Exists
label_asym_ids of heme V
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007q9e , Chain D 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-413 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 75GLY-87THR
Structural gaps Exists
label_asym_ids of heme DA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007zzl , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-411 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 73PHE-85PRO:164TYR-165GLN:175GLN-186GLU
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007zzl , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 5-411 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 73PHE-86ILE:164TYR-165GLN:175GLN-182LEU
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.21 Å
PDB ID:  pdb_00007zzl , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-413 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 75GLY-87THR
Structural gaps Exists
label_asym_ids of heme V
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007zzl , Chain D 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 4-413 (1-410), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 410insHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 75GLY-87THR
Structural gaps Exists
label_asym_ids of heme DA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å