- Protein: Uncharacterized protein
- Organism:
- Length: 262
- Sequence:
MNGGKLALLMVTLAAMGTLVLPSTTSLFLGQHMWYNISGTGNNLPCEKCHADVFAEFKNNPGAHKTIGGGTDTVEHIRAACGECHRTSVVGTFASGDGTSATPGQEAHAAATIACMACHEFGPNGNAPYSGAPVAGGFDNVTTDTASSPYNYDNGDTTYGTKEAHQTFIERAVEDKTLIDSNEACIACHTYVPVKINWTHKVSLEFNCTYEYNTGTSGVTTHYNVTNWTVNGTRYTTVFGNTTGNGSVNDASNWPGWYPYSW
| Residue indices (Uniprot), coverage | 31-250 (1-262), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B , C , D , E , B-2 , C-3 , E-3 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 31-250 (1-262), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B-1 , C-1 , D-1 , E-1 , C-2 , E-2 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 31-250 (1-262), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | C , E , B-1 , B-2 , C-2 , D-2 , E-2 |
| Available structure | PDB |