- Protein: Cytochrome c, mono-and diheme variant
- Organism:
- Length: 194
- Sequence:
MTIKTFLPKKIRGIALLTVSVLSVVMIPVAQSQLVFRNTVTGDVLDLSFGKKGEKTEAVEHFLNTGENLYNTDDEAIKAGESLFMTACSGCHGHHAEGKLGPALGDDYYTYPKNANDKGLFETIYGGARSMMGPQYNNLTKDEILHIMAWVRSVYWGSADKADWLTEEQKANFKPAEVPEDFKEAMDNFNKTHH
| Resolution | 2.13 Å |
|---|---|
| Residue indices (Uniprot), coverage | 33-183 (1-194), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.13 Å |
|---|---|
| Residue indices (Uniprot), coverage | 33-183 (1-194), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 2.13 Å |
|---|---|
| Residue indices (Uniprot), coverage | 34-183 (1-194), 1.00 |
| auth_asym_id | C |
| Structural gaps | Exists |
| label_asym_ids of heme | U |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |
| Resolution | 2.13 Å |
|---|---|
| Residue indices (Uniprot), coverage | 33-182 (1-194), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | AA |
| Available structure | PDB |