- Protein: Cytochrome c prime
- Organism: Pseudomonas hydrogenothermophila (Hydrogenophilus thermoluteolus)
- Length: 154
- Sequence:
MKRIAMITALTLCAAAAHADALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-135 (20-154), 0.88 |
| auth_asym_id | D |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-135 (20-154), 0.88 |
| auth_asym_id | D |
| label_asym_ids of heme | B-1 |
| Available structure | PDB |
| Resolution | 1.89 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-135 (20-154), 0.88 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.89 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-135 (20-154), 0.88 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.89 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-135 (20-154), 0.88 |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.89 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-135 (20-154), 0.88 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |