Danish
Uniprot ID:  F7J213
  • Protein: Cytochrome c prime
  • Organism: Pseudomonas hydrogenothermophila (Hydrogenophilus thermoluteolus)
  • Length: 154
  • Sequence:
    • MKRIAMITALTLCAAAAHADALKPEDKVKFRQASYTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSRLKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00008rkp , Chain A 
Resolution 1.63 Å
Residue indices (Uniprot), coverage 2-135 (21-154), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-D20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00008rkp , Chain A-1 
Resolution 1.63 Å
Residue indices (Uniprot), coverage 2-135 (21-154), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-D20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00008brl , Chain A 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008brl , Chain A-1 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005b3i , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00005b3i , Chain B 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00005b3i , Chain C 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00005b3i , Chain D 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 1-135 (20-154), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB