- Protein: Globin domain-containing protein
- Organism: Wild turkey (Meleagris gallopavo)
- Length: 200
- Sequence:
MQPIAGCTGKRRGPAERIKVGTQTAAHQRAIPAGARAQTSSVPTATRYPPTAAMVHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (55-200), 0.73 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (55-200), 0.73 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (55-200), 0.73 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (55-200), 0.73 |
| auth_asym_id | D |
| label_asym_ids of heme | K |
| Available structure | PDB |