Danish

Uniprot ID: I7FPH1

Protein: Cytochrome bc1 complex cytochrome c subunit
Organism: Mycobacterium smegmatis (Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155))
Length: 294
Sequence:

MDRAVRHHLLRPMNIGSPMSSMRRGSMTSKSRRRLRRRLSAGLLLLIGLAVAGGVAATLTPQPQVAVADESQSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGRMPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQESLIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTAMLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPEGMAMWIIGMVAAIGVAMWIGSRA

Number of chains: 8

PDB ID: 6adq , Chain K
Residue indices (Uniprot), coverage	72-294 (1-294), 1.00
auth_asym_id	C
label_asym_ids of heme	CB , DB
Available structure	PDB

PDB ID: 6adq , Chain W
Residue indices (Uniprot), coverage	72-294 (1-294), 1.00
auth_asym_id	O
label_asym_ids of heme	MC , NC
Available structure	PDB

PDB ID: 7rh5 , Chain M
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
auth_asym_id	O
label_asym_ids of heme	IB , JB
Available structure	PDB

PDB ID: 7rh5 , Chain U
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
auth_asym_id	I
label_asym_ids of heme	ZB , AC
Available structure	PDB

PDB ID: 7rh6 , Chain A
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
auth_asym_id	O
Structural gaps	Exists
label_asym_ids of heme	X , Y
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	15.78 Å

PDB ID: 7rh6 , Chain V
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
auth_asym_id	I
label_asym_ids of heme	YB , ZB
Available structure	PDB

PDB ID: 7rh7 , Chain J
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	O
label_asym_ids of heme	PA , QA
Available structure	PDB

PDB ID: 7rh7 , Chain U
Residue indices (Uniprot), coverage	72-294 (72-294), 0.76
auth_asym_id	I
label_asym_ids of heme	SB , TB
Available structure	PDB