- Protein: Obtusifoliol 14alphademethylase, putative
- Organism:
- Length: 486
- Sequence:
MVAAAALELFSAHPFIFGPLVLVALLALIVKVREWRKYGGYNLPPVVSSLIPFVGSGLSFAGGPLQYTTDAYKKYGDIFTMKVFGQRLTFLVGPDAHVPFFSQGDAELSQDEPYQFSVPIFGPNVVYGADLAHRNQQLKFIAASLSTKALQSYVPLIVKEAEDFFAKWDKSGTVDIRDALAELIILTASRCLMGKEIRENLFTEVAKLYQTLDEGLLPISVFFPYLPIPAHKRRDEARLAMVRMFKKIIDERRANPEVKHNDCLQVFMDARYRGEEQALNDEEITGLMIALLFAGQHTSSVTGSWTGLLLFEANNKKKFLPGVLEEQEEIRKEFGDELTMEALNKMDKLHRCVKEALRMYPPLLFVMRKVIKPFSYKDYYVPEGDTVFVSPALSMRVEEVFPNADQYNPERFVEEDKQAQKYRFVGFGAGRHGCMGENFAYLQIKTIWSVLLRNFDIELVGELPKPDYTAMVVGPAHPCLLRYTRK
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-488 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 39-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 43-486 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 43-486 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-488 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 2.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-488 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | C |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 2.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 41-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | D |
| label_asym_ids of heme | R |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-488 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 41-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 41-486 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | C |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 41-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | D |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 41-488 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | E |
| label_asym_ids of heme | Q |
| Available structure | PDB |
| Resolution | 2.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 40-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | F |
| label_asym_ids of heme | S |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 74-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 74-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | C |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 74-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | D |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 75-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | E |
| label_asym_ids of heme | P |
| Available structure | PDB |
| Resolution | 2.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 75-487 (43-486), 0.91 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | F |
| label_asym_ids of heme | R |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | C |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | D |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | E |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 74-486 (43-486), 0.91 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | F |
| label_asym_ids of heme | Q |
| Available structure | PDB |