Danish
Uniprot ID:  L8GJB3
  • Protein: Obtusifoliol 14alphademethylase, putative
  • Organism: Acanthamoeba castellanii (strain ATCC 30010 / Neff)
  • Length: 486
  • Sequence:
    • MVAAAALELFSAHPFIFGPLVLVALLALIVKVREWRKYGGYNLPPVVSSLIPFVGSGLSFAGGPLQYTTDAYKKYGDIFTMKVFGQRLTFLVGPDAHVPFFSQGDAELSQDEPYQFSVPIFGPNVVYGADLAHRNQQLKFIAASLSTKALQSYVPLIVKEAEDFFAKWDKSGTVDIRDALAELIILTASRCLMGKEIRENLFTEVAKLYQTLDEGLLPISVFFPYLPIPAHKRRDEARLAMVRMFKKIIDERRANPEVKHNDCLQVFMDARYRGEEQALNDEEITGLMIALLFAGQHTSSVTGSWTGLLLFEANNKKKFLPGVLEEQEEIRKEFGDELTMEALNKMDKLHRCVKEALRMYPPLLFVMRKVIKPFSYKDYYVPEGDTVFVSPALSMRVEEVFPNADQYNPERFVEEDKQAQKYRFVGFGAGRHGCMGENFAYLQIKTIWSVLLRNFDIELVGELPKPDYTAMVVGPAHPCLLRYTRK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  26
PDB ID:  pdb_00006q2c , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 40-488 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006q2c , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 39-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007uwp , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 43-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007uwp , Chain B 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 43-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00008ekt , Chain A 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00008ekt , Chain B 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00008ekt , Chain C 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00008ekt , Chain D 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00008ekt , Chain E 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id E
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00008ekt , Chain F 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id F
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00007les , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-488 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007les , Chain B 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-487 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00007les , Chain C 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-488 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id C
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00007les , Chain D 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 41-487 (43-486), 0.93
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id D
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain A 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 40-488 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain B 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 41-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain C 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 41-486 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain D 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 41-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain E 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 41-488 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00006uw2 , Chain F 
Resolution 2.92 Å
Residue indices (Uniprot), coverage 40-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id F
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain A 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 74-486 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain B 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 74-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain C 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 74-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain D 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 74-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id D
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain E 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 75-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id E
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00006ux0 , Chain F 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 75-487 (43-486), 0.93
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E34A, W35K, R36K, K37T, Y38S, G39S, G40K, Y41G, N42K
Insertions 486insHHHHHH
Deletions V2-R33
Sequence identity to UniProt 0.9802
auth_asym_id F
label_asym_ids of heme R
Available structure PDB