- Protein: Fructose dehydrogenase cytochrome subunit
- Organism:
- Length: 486
- Sequence:
MRYFRPLSATAMTTVLLLAGTNVRAQPTEPTPASAHRPSISRGHYLAIAADCAACHTNGRDGQFLAGGYAISSPMGNIYSTNITPSKTHGIGNYTLEQFSKALRHGIRADGAQLYPAMPYDAYNRLTDEDVKSLYAYIMTEVKPVDAPSPKTQLPFPFSIRASLGIWKIAARIEGKPYVFDHTHNDDWNRGRYLVDELAHCGECHTPRNFLLAPNQSAYLAGADIGSWRAPNITNAPQSGIGSWSDQDLFQYLKTGKTAHARAAGPMAEAIEHSLQYLPDADISAIVTYLRSVPAKAESGQTVANFEHAGRPSSYSVANANSRRSNSTLTKTTDGAALYEAVCASCHQSDGKGSKDGYYPSLVGNTTTGQLNPNDLIASILYGVDRTTDNHEILMPAFGPDSLVQPLTDEQIATIADYVLSHFGNAQATVSADAVKQVRAGGKQVPLAKLASPGVMLLLGTGGILGAILVVAGLWWLISRRKKRSA
| Residue indices (Uniprot), coverage | 40-471 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| Structural gaps | Exists |
| label_asym_ids of heme | I , J , K |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.15 Å |
| Residue indices (Uniprot), coverage | 40-471 (1-486), 1.00 |
|---|---|
| auth_asym_id | F |
| Structural gaps | Exists |
| label_asym_ids of heme | N , O , P |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Residue indices (Uniprot), coverage | 40-471 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| Structural gaps | Exists |
| label_asym_ids of heme | I , J , K |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Residue indices (Uniprot), coverage | 40-471 (1-486), 1.00 |
|---|---|
| auth_asym_id | F |
| Structural gaps | Exists |
| label_asym_ids of heme | N , O , P |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Residue indices (Uniprot), coverage | 40-452 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| label_asym_ids of heme | F , G , H |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 40-452 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| label_asym_ids of heme | F , G , H |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 40-452 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| label_asym_ids of heme | F , G , H |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 40-452 (1-486), 1.00 |
|---|---|
| auth_asym_id | C |
| label_asym_ids of heme | F , G , H |
| Available structure | PDB |