Danish
Uniprot ID:  M1V1V5
  • Protein: Fructose dehydrogenase cytochrome subunit
  • Organism: Gluconobacter japonicus
  • Length: 486
  • Sequence:
    • MRYFRPLSATAMTTVLLLAGTNVRAQPTEPTPASAHRPSISRGHYLAIAADCAACHTNGRDGQFLAGGYAISSPMGNIYSTNITPSKTHGIGNYTLEQFSKALRHGIRADGAQLYPAMPYDAYNRLTDEDVKSLYAYIMTEVKPVDAPSPKTQLPFPFSIRASLGIWKIAARIEGKPYVFDHTHNDDWNRGRYLVDELAHCGECHTPRNFLLAPNQSAYLAGADIGSWRAPNITNAPQSGIGSWSDQDLFQYLKTGKTAHARAAGPMAEAIEHSLQYLPDADISAIVTYLRSVPAKAESGQTVANFEHAGRPSSYSVANANSRRSNSTLTKTTDGAALYEAVCASCHQSDGKGSKDGYYPSLVGNTTTGQLNPNDLIASILYGVDRTTDNHEILMPAFGPDSLVQPLTDEQIATIADYVLSHFGNAQATVSADAVKQVRAGGKQVPLAKLASPGVMLLLGTGGILGAILVVAGLWWLISRRKKRSA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  11
PDB ID:  pdb_00007w2j , Chain C 
Residue indices (Uniprot), coverage 40-471 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 318ALA-331LYS
Structural gaps Exists
label_asym_ids of heme K ,  J ,  I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00007w2j , Chain F 
Residue indices (Uniprot), coverage 40-471 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 318ALA-331LYS
Structural gaps Exists
label_asym_ids of heme P ,  O ,  N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007wsq , Chain C 
Residue indices (Uniprot), coverage 40-471 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 318ALA-331LYS
Structural gaps Exists
label_asym_ids of heme K ,  J ,  I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007wsq , Chain F 
Residue indices (Uniprot), coverage 40-471 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 318ALA-331LYS
Structural gaps Exists
label_asym_ids of heme P ,  O ,  N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008jej , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00008jek , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00008k6j , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00008k6k , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00008xcm , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00008xcn , Chain C 
Residue indices (Uniprot), coverage 40-452 (1-486), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H ,  G ,  F
Available structure PDB
PDB ID:  pdb_00009jqa , Chain C 
Residue indices (Uniprot), coverage 177-444 (139-486), 0.66
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions None
Deletions P27-I169, G454-W476
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G ,  F
Available structure PDB