- Protein: Anaerobic nitrite reductase NSHB1
- Organism: Rice (Oryza sativa subsp. japonica)
- Length: 166
- Sequence:
MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-165 (2-166), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 11-165 (2-166), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-165 (1-166), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-165 (1-166), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-165 (2-166), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-165 (2-166), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |