Danish
Uniprot ID:  O04986
  • Protein: Anaerobic nitrite reductase NSHB1
  • Organism: Rice (Oryza sativa subsp. japonica)
  • Length: 166
  • Sequence:
    • MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00002gnv , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 8-165 (2-166), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F41L
Insertions None
Deletions M1
Sequence identity to UniProt 0.9939
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002gnv , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 11-165 (2-166), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F41L
Insertions None
Deletions M1
Sequence identity to UniProt 0.9939
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001d8u , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-165 (1-166), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001d8u , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-165 (1-166), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00002gnw , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-165 (2-166), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F41W
Insertions None
Deletions M1
Sequence identity to UniProt 0.9939
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002gnw , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-165 (2-166), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F41W
Insertions None
Deletions M1
Sequence identity to UniProt 0.9939
auth_asym_id B
label_asym_ids of heme D
Available structure PDB