Danish
Uniprot ID:  O34453
  • Protein: Nitric oxide synthase oxygenase
  • Organism: Bacillus subtilis (strain 168)
  • Length: 363
  • Sequence:
    • MEEKEILWNEAKAFIAACYQELGKEEEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  170
PDB ID:  pdb_00004d3t , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3t , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d7j , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d7j , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugk , Chain A 
Resolution 1.62 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugk , Chain A-1 
Resolution 1.62 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g68 , Chain A 
Resolution 1.63 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g68 , Chain A-1 
Resolution 1.63 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3j , Chain A 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3j , Chain A-1 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6o , Chain A 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6o , Chain A-1 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004uqr , Chain A 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uqr , Chain A-1 
Resolution 1.72 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3m , Chain A 
Resolution 1.74 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3m , Chain A-1 
Resolution 1.74 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ug7 , Chain A 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ug7 , Chain A-1 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g66 , Chain A 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g66 , Chain A-1 
Resolution 1.76 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6m , Chain A 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6m , Chain A-1 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugj , Chain A 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugj , Chain A-1 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugp , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugp , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugc , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugc , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugi , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugi , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugu , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugu , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugy , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugy , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6b , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6b , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ug6 , Chain A 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ug6 , Chain A-1 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugf , Chain A 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugf , Chain A-1 
Resolution 1.81 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugl , Chain A 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugl , Chain A-1 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6d , Chain A 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6d , Chain A-1 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xk6 , Chain A 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
Missing residues 161ARG-161ARG
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00006xk6 , Chain A-1 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
Missing residues 161ARG-161ARG
Structural gaps Exists
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004ug9 , Chain A 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ug9 , Chain A-1 
Resolution 1.84 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugq , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugq , Chain A-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xk7 , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006xk7 , Chain A-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xmc , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006xmc , Chain A-1 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_000011yv , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_000011yv , Chain A-1 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 1-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugx , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugx , Chain A-1 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xk5 , Chain A 
Resolution 1.87 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3v , Chain A 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3v , Chain A-1 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6j , Chain A 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6j , Chain A-1 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ug8 , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ug8 , Chain A-1 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3o , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-362 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3o , Chain A-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-362 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004uga , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uga , Chain A-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugw , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A, Y357F
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugw , Chain A-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A, Y357F
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6n , Chain A 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6n , Chain A-1 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6h , Chain A 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 3-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6h , Chain A-1 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 3-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugb , Chain A 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugb , Chain A-1 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6a , Chain A 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6a , Chain A-1 
Resolution 1.92 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00001m7v , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9532
auth_asym_id A
Missing residues 134SER-135ASP
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00001m7v , Chain A-1 
Resolution 1.95 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9532
auth_asym_id A
Missing residues 134SER-135ASP
Structural gaps Exists
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006xk3 , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6k , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6k , Chain A-1 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d7i , Chain A 
Resolution 1.96 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d7i , Chain A-1 
Resolution 1.96 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g67 , Chain A 
Resolution 1.97 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g67 , Chain A-1 
Resolution 1.97 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3u , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E25A, E26A, H128S, E316A
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3u , Chain A-1 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E25A, E26A, H128S, E316A
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6g , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6g , Chain A-1 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6i , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6i , Chain A-1 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugv , Chain A 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A, Y357F
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugv , Chain A-1 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A, Y357F
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugs , Chain A 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugs , Chain A-1 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugh , Chain A 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugh , Chain A-1 
Resolution 1.99 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002fc1 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9529
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002fc1 , Chain A-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9529
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g69 , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g69 , Chain A-1 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3k , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004d3k , Chain B 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-362 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004d7h , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d7h , Chain A-1 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugd , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugd , Chain A-1 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugt , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 3-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugt , Chain A-1 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 3-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g65 , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g65 , Chain A-1 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6q , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6q , Chain A-1 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6l , Chain A 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6l , Chain A-1 
Resolution 2.03 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004lwa , Chain A 
Resolution 2.06 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3i , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 1-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3i , Chain A-1 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 1-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugm , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugm , Chain A-1 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugn , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugn , Chain A-1 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugr , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugr , Chain A-1 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002fbz , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9532
auth_asym_id X
Missing residues 134SER-135ASP
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002fbz , Chain A-1 
Resolution 2.10 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9532
auth_asym_id X
Missing residues 134SER-135ASP
label_asym_ids of heme B-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00005g6e , Chain A 
Resolution 2.11 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6e , Chain A-1 
Resolution 2.11 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004d3n , Chain A 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004d3n , Chain A-1 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6c , Chain A 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6c , Chain A-1 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xk4 , Chain A 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006xk4 , Chain A-1 
Resolution 2.13 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00001m7z , Chain A 
Resolution 2.14 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9529
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001m7z , Chain A-1 
Resolution 2.14 Å
Residue indices (Uniprot), coverage -3-359 (5-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, L41R, E88D, T109S, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9529
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004uge , Chain A 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uge , Chain A-1 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004lwb , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uqs , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uqs , Chain A-1 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6p , Chain A 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6p , Chain A-1 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, I218V, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9890
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002fc2 , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage -2-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, E88D, T109S, S138A, D139A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9559
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002fc2 , Chain A-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage -2-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, E88D, T109S, S138A, D139A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9559
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00002fc2 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage -2-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, E88D, T109S, S138A, D139A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9559
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00002fc2 , Chain B-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage -2-359 (5-363), 1.00
Mutations (UniProt numbering) M1G, E2S, E3H, K4M, A17E, A33D, D34S, E88D, T109S, S138A, D139A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9559
auth_asym_id B
label_asym_ids of heme K-1
Available structure PDB
PDB ID:  pdb_00006xk8 , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006xk8 , Chain A-1 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00006xcx , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006xcx , Chain A-1 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00005g6f , Chain A 
Resolution 2.26 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005g6f , Chain A-1 
Resolution 2.26 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ug5 , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ug5 , Chain A-1 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugg , Chain A 
Resolution 2.36 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugg , Chain A-1 
Resolution 2.36 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00004ugo , Chain A 
Resolution 2.38 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004ugo , Chain A-1 
Resolution 2.38 Å
Residue indices (Uniprot), coverage 2-363 (1-363), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E25A, E26A, E316A
Insertions None
Deletions None
Sequence identity to UniProt 0.9917
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002amo , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (30-363), 1.00
Difference from Uniprot sequence conflict:insertion
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, S138A, D139A, R142A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions M1
Sequence identity to UniProt 0.9448
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002amo , Chain A-1 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (30-363), 1.00
Difference from Uniprot sequence conflict:insertion
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, S138A, D139A, R142A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions M1
Sequence identity to UniProt 0.9448
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00002amo , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (30-363), 1.00
Difference from Uniprot sequence conflict:insertion
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, S138A, D139A, R142A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions M1
Sequence identity to UniProt 0.9448
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00002amo , Chain B-1 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (30-363), 1.00
Difference from Uniprot sequence conflict:insertion
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, S138A, D139A, R142A, E157Q, A268S, A269T, D270N, H290Y
Insertions None
Deletions M1
Sequence identity to UniProt 0.9448
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00002an0 , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -3-359 (6-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, L41R, E88D, T109S, R142A, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y, P336G
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9363
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002an0 , Chain A-1 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -3-359 (6-363), 0.99
Mutations (UniProt numbering) M1G, E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, L41R, E88D, T109S, R142A, C149R, E157Q, K177R, A268S, A269T, D270N, H290Y, P336G
Insertions None
Deletions S138-D139
Sequence identity to UniProt 0.9363
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00002an2 , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (6-363), 0.99
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, R142A, E157Q, A268S, A269T, D270N, H290Y, P336G, A337S
Insertions None
Deletions M1, S138-D139
Sequence identity to UniProt 0.9444
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002an2 , Chain A-1 
Resolution 2.60 Å
Residue indices (Uniprot), coverage -2-359 (6-363), 0.99
Mutations (UniProt numbering) E2S, E3H, K4A, E5A, A17E, Q20A, E25A, K29A, A33D, D34S, E88D, T109S, R142A, E157Q, A268S, A269T, D270N, H290Y, P336G, A337S
Insertions None
Deletions M1, S138-D139
Sequence identity to UniProt 0.9444
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB