Danish
Uniprot ID:  O59651
  • Protein: Catalase-peroxidase 2
  • Organism: Halobacterium marismortui (Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809))
  • Length: 731
  • Sequence:
    • MAETPNSDMSGATGGRSKRPKSNQDWWPSKLNLEILDQNARDVGPVEDDFDYAEEFQKLDLEAVKSDLEELMTSSQDWWPADYGHYGPLFIRMAWHSAGTYRTADGRGGAAGGRQRFAPINSWPDNANLDKARRLLLPIKQKYGQKISWADLMILAGNVAIESMGFKTFGYAGGREDAFEEDKAVNWGPEDEFETQERFDEPGEIQEGLGASVMGLIYVNPEGPDGNPDPEASAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGADDPEENLGPEPEAAPIEQQGLGWQNKNGNSKGGEMITSGIEGPWTQSPTEWDMGYINNLLDYEWEPEKGPGGAWQWAPKSEELKNSVPDAHDPDEKQTPMMLTTDIALKRDPDYREVMETFQENPMEFGMNFAKAWYKLTHRDMGPPERFLGPEVPDEEMIWQDPLPDADYDLIGDEEIAELKEEILDSDLSVSQLVKTAWASASTYRDSDKRGGANGARLRLEPQKNWEVNEPEQLETVLGTLENIQTEFNDSRSDGTQVSLADLIVLGGNAAVEQAAANAGYDVEIPFEPGRVDAGPEHTDAPSFDALKPKVDGVRNYIQDDITRPAEEVLVDNADLLNLTASELTALIGGMRSIGANYQDTDLGVFTDEPETLTNDFFVNLLDMGTEWEPAADSEHRYKGLDRDTGEVKWEATRIDLIFGSNDRLRAISEVYGSADAEKKLVHDFVDTWSKVMKLDRFDLE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  16
PDB ID:  pdb_00003vli , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
Missing residues 295GLY-297SER
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003vli , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003vlj , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
Missing residues 293LYS-300GLY
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003vlj , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
Missing residues 293LYS-301GLU
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003vlh , Chain A 
Resolution 1.73 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
Missing residues 295GLY-298LYS
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00003vlh , Chain B 
Resolution 1.73 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) R409L
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001itk , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 295GLY-301GLU
Structural gaps Exists
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00001itk , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme FA
Available structure PDB
PDB ID:  pdb_00003vlk , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003vlk , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003vll , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
Missing residues 292ASN-302MET
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00003vll , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
Missing residues 662ALA-665GLU
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 1.14 Å
PDB ID:  pdb_00003vlm , Chain A 
Resolution 2.33 Å
Residue indices (Uniprot), coverage 29-728 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M244A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003vlm , Chain B 
Resolution 2.33 Å
Residue indices (Uniprot), coverage 29-728 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) M244A
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003uw8 , Chain A 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305T
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003uw8 , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 18-731 (1-731), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) S305T
Insertions 731insHHHHHH
Deletions None
Sequence identity to UniProt 0.9986
auth_asym_id B
label_asym_ids of heme D
Available structure PDB