Danish

Uniprot ID: O59651

Protein: Catalase-peroxidase 2
Organism: Halobacterium marismortui (Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809))
Length: 731
Sequence:

MAETPNSDMSGATGGRSKRPKSNQDWWPSKLNLEILDQNARDVGPVEDDFDYAEEFQKLDLEAVKSDLEELMTSSQDWWPADYGHYGPLFIRMAWHSAGTYRTADGRGGAAGGRQRFAPINSWPDNANLDKARRLLLPIKQKYGQKISWADLMILAGNVAIESMGFKTFGYAGGREDAFEEDKAVNWGPEDEFETQERFDEPGEIQEGLGASVMGLIYVNPEGPDGNPDPEASAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGADDPEENLGPEPEAAPIEQQGLGWQNKNGNSKGGEMITSGIEGPWTQSPTEWDMGYINNLLDYEWEPEKGPGGAWQWAPKSEELKNSVPDAHDPDEKQTPMMLTTDIALKRDPDYREVMETFQENPMEFGMNFAKAWYKLTHRDMGPPERFLGPEVPDEEMIWQDPLPDADYDLIGDEEIAELKEEILDSDLSVSQLVKTAWASASTYRDSDKRGGANGARLRLEPQKNWEVNEPEQLETVLGTLENIQTEFNDSRSDGTQVSLADLIVLGGNAAVEQAAANAGYDVEIPFEPGRVDAGPEHTDAPSFDALKPKVDGVRNYIQDDITRPAEEVLVDNADLLNLTASELTALIGGMRSIGANYQDTDLGVFTDEPETLTNDFFVNLLDMGTEWEPAADSEHRYKGLDRDTGEVKWEATRIDLIFGSNDRLRAISEVYGSADAEKKLVHDFVDTWSKVMKLDRFDLE

Number of chains: 16

PDB ID: 3vli , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 3vli , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 3vlj , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 3vlj , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	F
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 3vlh , Chain A
Resolution	1.73 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 3vlh , Chain B
Resolution	1.73 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1itk , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	T
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1itk , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
auth_asym_id	B
label_asym_ids of heme	FA
Available structure	PDB

PDB ID: 3vlk , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 3vlk , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 3vll , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 3vll , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	1.14 Å

PDB ID: 3vlm , Chain A
Resolution	2.33 Å
Residue indices (Uniprot), coverage	29-728 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	C
Available structure	PDB (not modeled)

PDB ID: 3vlm , Chain B
Resolution	2.33 Å
Residue indices (Uniprot), coverage	29-728 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB (not modeled)

PDB ID: 3uw8 , Chain A
Resolution	2.35 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 3uw8 , Chain B
Resolution	2.35 Å
Residue indices (Uniprot), coverage	18-731 (1-731), 1.00
Difference from Uniprot sequence	engineered mutation:expression tag
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB