Danish
Uniprot ID:  O66586
  • Protein: Uncharacterized globin-like protein aq_211
  • Organism: Aquifex aeolicus (strain VF5)
  • Length: 139
  • Sequence:
    • MLSEETIRVIKSTVPLLKEHGTEITARMYELLFSKYPKTKELFAGASEEQPKKLANAIIAYATYIDRLEELDNAISTIARSHVRRNVKPEHYPLVKECLLQAIEEVLNPGEEVLKAWEEAYDFLAKTLITLEKKLYSQP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007dih , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-139 (1-139), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y29F
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007dih , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-137 (1-139), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y29F
Insertions 0insGSH
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id B
label_asym_ids of heme F
Available structure PDB