- Protein: Uncharacterized globin-like protein aq_211
- Organism:
- Length: 139
- Sequence:
MLSEETIRVIKSTVPLLKEHGTEITARMYELLFSKYPKTKELFAGASEEQPKKLANAIIAYATYIDRLEELDNAISTIARSHVRRNVKPEHYPLVKECLLQAIEEVLNPGEEVLKAWEEAYDFLAKTLITLEKKLYSQP
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-139 (1-139), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-139), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |