Danish
Uniprot ID:  P00045
  • Protein: Cytochrome c isoform 2
  • Organism: Baker's yeast (Saccharomyces cerevisiae (strain ATCC 204508 / S288c))
  • Length: 113
  • Sequence:
    • MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00001ytc , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage -9-103 (2-113), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N62I
Insertions None
Deletions M1
Sequence identity to UniProt 0.9911
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00001yea , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage -9-103 (2-113), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00001yea , Chain A-1 
Resolution 1.90 Å
Residue indices (Uniprot), coverage -9-103 (2-113), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00001yeb , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage -5-103 (6-111), 0.96
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) G7E, P10A, A93G, M108L, T109K, A112C, K113E
Insertions None
Deletions M1-S5
Sequence identity to UniProt 0.9352
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00001yeb , Chain A-1 
Resolution 1.95 Å
Residue indices (Uniprot), coverage -5-103 (6-111), 0.96
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) G7E, P10A, A93G, M108L, T109K, A112C, K113E
Insertions None
Deletions M1-S5
Sequence identity to UniProt 0.9352
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme C-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00003cxh , Chain W 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-112 (2-113), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id W
Missing residues 81LYS-81LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme UA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.20 Å