Danish

Uniprot ID: P00091

Protein: Cytochrome c2
Organism:
Length: 139
Sequence:

MVKKLLTILSIAATAGSLSIGTASAQDAKAGEAVFKQCMTCHRADKNMVGPALGGVVGRKAGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKKFLTDKGKADQAVGVTKMTFKLANEQQRKDVVAYLATLK

Number of chains: 10

PDB ID: 1i8o , Chain A
Resolution	1.15 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	A
Nonstandard amino acids	PCA
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1hh7 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	A
Nonstandard amino acids	PCA
label_asym_ids of heme	B
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 1fj0 , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	A
Nonstandard amino acids	PCA
label_asym_ids of heme	F
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 1fj0 , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	B
Nonstandard amino acids	PCA
label_asym_ids of heme	G
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1fj0 , Chain C
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	C
Nonstandard amino acids	PCA
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 1fj0 , Chain D
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	D
Nonstandard amino acids	PCA
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 1i8p , Chain A
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	A
Nonstandard amino acids	PCA
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1i8p , Chain B
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	B
Nonstandard amino acids	PCA
label_asym_ids of heme	F
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1i8p , Chain C
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	C
Nonstandard amino acids	PCA
label_asym_ids of heme	G
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 1i8p , Chain D
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-114 (26-139), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	D
Nonstandard amino acids	PCA
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å