Danish
Uniprot ID:  P00096
  • Protein: Cytochrome c-550
  • Organism: Paracoccus denitrificans
  • Length: 155
  • Sequence:
    • MKISIYATLAAITLALPAAAQDGDAAKGEKEFNKCKACHMIQAPDGTDIIKGGKTGPNLYGVVGRKIASEEGFKYGEGILEVAEKNPDLTWTEADLIEYVTDPKPWLVKMTDDKGAKTKMTFKMGKNQADVVAFLAQNSPDAGGDGEAAAEGESN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001cot , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-122 (21-149), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20, A150-N155
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_0000155c , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-134 (21-142), 0.87
Difference from Uniprot sequence conflict:deletion
Mutations (UniProt numbering) A20X, Q21N, D22E, D95N, W106L, L107V, V108K, N138D, S139D, G143X, G144X, D145X, G146X, E147X, A148X, A149X, A150X, E151X, G152X, E153X, S154X, N155X
Insertions None
Deletions M1-A19, I49
Sequence identity to UniProt 0.8370
auth_asym_id A
Nonstandard amino acids UNK Structure of UNKUNK
Unknown residues Included
label_asym_ids of heme B
Available structure PDB