- Protein: Cytochrome c-550
- Organism:
- Length: 155
- Sequence:
MKISIYATLAAITLALPAAAQDGDAAKGEKEFNKCKACHMIQAPDGTDIIKGGKTGPNLYGVVGRKIASEEGFKYGEGILEVAEKNPDLTWTEADLIEYVTDPKPWLVKMTDDKGAKTKMTFKMGKNQADVVAFLAQNSPDAGGDGEAAAEGESN
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-122 (21-149), 0.83 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-134 (21-142), 0.79 |
| Difference from Uniprot sequence | conflict:deletion |
| auth_asym_id | A |
| Nonstandard amino acids | UNK |
| Unknown residues | Included |
| label_asym_ids of heme | B |
| Available structure | PDB |