- Protein: Cytochrome c-551
- Organism: Pseudomonas stutzeri (Stutzerimonas stutzeri)
- Length: 104
- Sequence:
MKKILIPMLALGGALAMQPALAQDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK
| Residue indices (Uniprot), coverage | 1-82 (23-104), 0.79 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-82 (23-104), 0.79 |
|---|---|
| auth_asym_id | A |
| Nonstandard amino acids | PCA |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.19 Å |
| Residue indices (Uniprot), coverage | 1-82 (23-104), 0.79 |
|---|---|
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-82 (23-104), 0.79 |
|---|---|
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |