Danish
Uniprot ID:  P00101
  • Protein: Cytochrome c-551
  • Organism: Pseudomonas stutzeri (Stutzerimonas stutzeri)
  • Length: 104
  • Sequence:
    • MKKILIPMLALGGALAMQPALAQDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVEGAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001cch , Chain A 
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001cor , Chain A 
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Mutations (UniProt numbering) V40I, T42A, M44L, L49F, N56Y, V59Q, E60D, T65L, L68G, V100I, L103Q
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.8659
auth_asym_id A
Missing residues 1GLN-1GLN
Nonstandard amino acids PCA Structure of PCAPCA
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.20 Å
PDB ID:  pdb_00001fi3 , Chain A 
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) M83H
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9878
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002i8f , Chain A 
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) H69A
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9878
auth_asym_id A
label_asym_ids of heme B
Available structure PDB