Danish
Uniprot ID:  P00131
  • Protein: Cytochrome c3
  • Organism: Desulfovibrio vulgaris (Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough))
  • Length: 129
  • Sequence:
    • MRKLFFCGVLALAVAFALPVVAAPKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00002cth , Chain A 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00002cth , Chain B 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G ,  H ,  I ,  J
Available structure PDB
PDB ID:  pdb_00002cym , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00001mdv , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 7-107 (23-129), 0.83
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) F42L
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00001mdv , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 8-107 (23-129), 0.83
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) F42L
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9907
auth_asym_id B
label_asym_ids of heme G ,  H ,  I ,  J
Available structure PDB
PDB ID:  pdb_00001a2i , Chain A 
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00001gx7 , Chain C 
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme Q ,  P ,  O ,  N
Available structure PDB
PDB ID:  pdb_00002bpn , Chain A 
Residue indices (Uniprot), coverage 1-107 (23-129), 0.83
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB