Danish

Uniprot ID: P00132

Protein: Cytochrome c3
Organism: Desulfovibrio vulgaris (Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F))
Length: 130
Sequence:

MKKMFLTGVLALAVAIAMPALAAAPKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTGCKGSKCHS

Number of chains: 14

PDB ID: 1j0p , Chain A
Resolution	0.91 Å
Residue indices (Uniprot), coverage	0-107 (23-130), 0.83
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	D , E , F , G
Available structure	PDB

PDB ID: 2ewi , Chain A
Resolution	1.00 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2ewk , Chain A
Resolution	1.00 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2yyx , Chain A
Resolution	1.00 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2ewu , Chain A
Resolution	1.10 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1j0o , Chain A
Resolution	1.15 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2yyw , Chain A
Resolution	1.33 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1wr5 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	0-107 (23-130), 0.83
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2yxc , Chain A
Resolution	1.50 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2z47 , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	C , D , E , F
Available structure	PDB

PDB ID: 2z47 , Chain B
Resolution	1.60 Å
Residue indices (Uniprot), coverage	2001-2107 (24-130), 0.82
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	G , H , I , J
Available structure	PDB

PDB ID: 2cdv , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 2ffn , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1it1 , Chain A
Residue indices (Uniprot), coverage	1-107 (24-130), 0.82
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB