Danish
Uniprot ID:  P00132
  • Protein: Cytochrome c3
  • Organism: Desulfovibrio vulgaris (Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F))
  • Length: 130
  • Sequence:
    • MKKMFLTGVLALAVAIAMPALAAAPKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTGCKGSKCHS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00001j0p , Chain A 
Resolution 0.91 Å
Residue indices (Uniprot), coverage 0-107 (23-130), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y66L
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00002ewi , Chain A 
Resolution 1.00 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F43Y
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00002ewk , Chain A 
Resolution 1.00 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T47V
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00002yyx , Chain A 
Resolution 1.00 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y88A
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00002ewu , Chain A 
Resolution 1.10 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F43H
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001j0o , Chain A 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00002yyw , Chain A 
Resolution 1.33 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F43M
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001wr5 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 0-107 (23-130), 0.83
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E64K
Insertions None
Deletions M1-A22
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00002yxc , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) H48M
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00002z47 , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y89L
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme F ,  E ,  D ,  C
Available structure PDB
PDB ID:  pdb_00002z47 , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 2001-2107 (24-130), 0.82
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y89L
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id B
label_asym_ids of heme J ,  I ,  H ,  G
Available structure PDB
PDB ID:  pdb_00002cdv , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D65N
Insertions None
Deletions M1-A23
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00002ffn , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001it1 , Chain A 
Residue indices (Uniprot), coverage 1-107 (24-130), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A23
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB