- Protein: Cytochrome c'
- Organism:
- Length: 146
- Sequence:
MKLRIATIAGLVVLGSGFAVAQTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS
| Resolution | 1.78 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-123 (22-146), 0.86 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.78 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-123 (22-146), 0.86 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-125 (22-146), 0.86 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-125 (22-146), 0.86 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |