Danish
Uniprot ID:  P00149
  • Protein: Cytochrome c'
  • Organism: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
  • Length: 146
  • Sequence:
    • MKLRIATIAGLVVLGSGFAVAQTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001mqv , Chain A 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-123 (22-146), 0.86
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q22A, F53W, W93F
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9760
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001mqv , Chain B 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-123 (22-146), 0.86
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q22A, F53W, W93F
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9760
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001a7v , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-125 (22-146), 0.86
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001a7v , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-125 (22-146), 0.86
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A21
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB