Danish

Uniprot ID: P00158

Protein: Cytochrome b
Organism: Mouse (Mus musculus)
Length: 381
Sequence:

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYP

Number of chains: 14

PDB ID: 7o37 , Chain C
Residue indices (Uniprot), coverage	2-381 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	KA , LA
Available structure	PDB

PDB ID: 7o37 , Chain M
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	AB , BB
Available structure	PDB

PDB ID: 7o3c , Chain C
Residue indices (Uniprot), coverage	2-380 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	KA , LA
Available structure	PDB

PDB ID: 7o3c , Chain M
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	WA , XA
Available structure	PDB

PDB ID: 7o3e , Chain C
Residue indices (Uniprot), coverage	2-381 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	FA , GA
Available structure	PDB

PDB ID: 7o3e , Chain J
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	QA , RA
Available structure	PDB

PDB ID: 7o3h , Chain C
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	X , Y
Available structure	PDB

PDB ID: 7o3h , Chain M
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	IA , JA
Available structure	PDB

PDB ID: 8pw5 , Chain C
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	QC , RC
Available structure	PDB

PDB ID: 8pw5 , Chain M
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	GD , HD
Available structure	PDB

PDB ID: 8pw6 , Chain C
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	DC , EC
Available structure	PDB

PDB ID: 8pw6 , Chain M
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	SC , TC
Available structure	PDB

PDB ID: 8pw7 , Chain P
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	C
label_asym_ids of heme	SC , TC
Available structure	PDB

PDB ID: 8pw7 , Chain Z
Residue indices (Uniprot), coverage	1-380 (1-381), 1.00
auth_asym_id	N
label_asym_ids of heme	HD , ID
Available structure	PDB