- Protein: Cytochrome b6-f complex subunit 4
- Organism: Spinach (Spinacia oleracea)
- Length: 160
- Sequence:
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPSMIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPAGLLTVPFLENVNKFQNPFRRPVATTVFLVGTVVALWLGIGATLPIDKSLTLGLF
| Residue indices (Uniprot), coverage | 1-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | J |
| label_asym_ids of heme | S |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | GA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | S |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | J |
| label_asym_ids of heme | LA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | U |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-160 (1-160), 1.00 |
|---|---|
| auth_asym_id | J |
| label_asym_ids of heme | KA |
| Available structure | PDB |