Danish
Uniprot ID:  P00173
  • Protein: Cytochrome b5
  • Organism: Rat (Rattus norvegicus)
  • Length: 134
  • Sequence:
    • MAEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYRLYMAED
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  10
PDB ID:  pdb_00001aqa , Chain A 
Residue indices (Uniprot), coverage 5-88 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001aw3 , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001axx , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001b5a , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001b5b , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001bfx , Chain A 
Residue indices (Uniprot), coverage 1-94 (1-99), 0.74
Mutations (UniProt numbering) None
Insertions None
Deletions I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001blv , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001ib7 , Chain A 
Residue indices (Uniprot), coverage 4-88 (6-99), 0.70
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F40Y
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 0.9894
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001jex , Chain A 
Residue indices (Uniprot), coverage 4-88 (6-99), 0.70
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A72V
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 0.9894
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002axx , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB