Danish

Uniprot ID: P00173

Protein: Cytochrome b5
Organism: Rat (Rattus norvegicus)
Length: 134
Sequence:

MAEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISALVVALMYRLYMAED

Number of chains: 10

PDB ID: 1aqa , Chain A
Residue indices (Uniprot), coverage	5-88 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1aw3 , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1axx , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1b5a , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1b5b , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1bfx , Chain A
Residue indices (Uniprot), coverage	1-94 (1-99), 0.74
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1blv , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1ib7 , Chain A
Residue indices (Uniprot), coverage	4-88 (6-99), 0.70
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1jex , Chain A
Residue indices (Uniprot), coverage	4-88 (6-99), 0.70
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2axx , Chain A
Residue indices (Uniprot), coverage	1-94 (6-99), 0.70
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB