- Protein: Hemoglobin subunit alpha
- Organism: Horse (Equus caballus)
- Length: 142
- Sequence:
MVLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict:variant |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict:variant |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 1.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-140 (2-141), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-140 (2-141), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | CONFLICT |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | CONFLICT |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | None |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | None |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.46 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.46 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | C |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-139 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 3.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 3.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-140 (2-141), 0.99 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 2-140 (2-141), 0.99 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-140 (2-142), 0.99 |
|---|---|
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-140 (2-142), 0.99 |
|---|---|
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |