Danish
Uniprot ID:  P01990
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Bar-headed goose (Anser indicus)
  • Length: 142
  • Sequence:
    • MVLSAADKTNVKGVFSKISGHAEEYGAETLERMFTAYPQTKTYFPHFDLQHGSAQIKAHGKKVVAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00001a4f , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001a4f , Chain A-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00001c40 , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D86N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001c40 , Chain A-1 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D86N
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00001hv4 , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001hv4 , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001hv4 , Chain E 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001hv4 , Chain G 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme O
Available structure PDB