Danish

Uniprot ID: P01990

Protein: Hemoglobin subunit alpha-A
Organism: Bar-headed goose (Anser indicus)
Length: 142
Sequence:

MVLSAADKTNVKGVFSKISGHAEEYGAETLERMFTAYPQTKTYFPHFDLQHGSAQIKAHGKKVVAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPSALTAEVHASLDKFLCAVGTVLTAKYR

Number of chains: 8

PDB ID: 1a4f , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1a4f , Chain A-1
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	A
label_asym_ids of heme	C-1
Available structure	PDB

PDB ID: 1c40 , Chain A
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1c40 , Chain A-1
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C-1
Available structure	PDB

PDB ID: 1hv4 , Chain A
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	A
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 1hv4 , Chain C
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	C
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 1hv4 , Chain E
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	E
label_asym_ids of heme	M
Available structure	PDB

PDB ID: 1hv4 , Chain G
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	G
label_asym_ids of heme	O
Available structure	PDB