Danish

Uniprot ID: P02008

Protein: Hemoglobin subunit zeta
Organism: Human (Homo sapiens)
Length: 142
Sequence:

MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

Number of chains: 6

PDB ID: 3w4u , Chain A
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-141 (1-142), 1.00
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 3w4u , Chain C
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-141 (1-142), 1.00
auth_asym_id	C
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 3w4u , Chain E
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-138 (1-142), 1.00
auth_asym_id	E
label_asym_ids of heme	O
Available structure	PDB

PDB ID: 3w4u , Chain E-1
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-138 (1-142), 1.00
auth_asym_id	E
label_asym_ids of heme	O-1
Available structure	PDB

PDB ID: 1jeb , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1jeb , Chain C
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB