- Protein: Hemoglobin subunit delta
- Organism: Human (Homo sapiens)
- Length: 147
- Sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 1.88 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | U |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | L |
| Available structure | PDB |