Danish
Uniprot ID:  P02042
  • Protein: Hemoglobin subunit delta
  • Organism: Human (Homo sapiens)
  • Length: 147
  • Sequence:
    • MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001shr , Chain B 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00001shr , Chain D 
Resolution 1.88 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00001si4 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001si4 , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme L
Available structure PDB