- Protein: Hemoglobin subunit beta
- Organism: Horse (Equus caballus)
- Length: 146
- Sequence:
VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F-1 |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 201-346 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 201-346 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F-1 |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E-1 |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E-1 |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 1.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.92 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | D-1 |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.15 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | E-1 |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.46 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.46 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 2.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 3.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 3.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
|---|---|
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |