- Protein: Hemoglobin subunit beta-3
- Organism: Virginia white-tailed deer (Odocoileus virginianus virginianus)
- Length: 145
- Sequence:
MLTAEEKAAVTGFWGKVNVDVVGAEALGRLLVVYPWTQRFFEHFGDLSSAGAVMGNPKVKAHGKRVLDAFSEGLKHLDDLKGAFAELSELHCNKLHVDPENFRLLGNVLVVVLARNFGGEFTPLVQADFQKVVAGVANALAHRYH
| Resolution | 1.98 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.98 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |