Danish
Uniprot ID:  P02088
  • Protein: Hemoglobin subunit beta-1
  • Organism: Mouse (Mus musculus)
  • Length: 147
  • Sequence:
    • MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001jeb , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-143 (2-147), 0.99
Mutations (UniProt numbering) C14G, S21A, T140A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9795
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001jeb , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) C14G, S21A, T140A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9795
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00003hrw , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003hrw , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB