- Protein: Hemoglobin subunit beta-1
- Organism: Mouse (Mus musculus)
- Length: 147
- Sequence:
MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-143 (2-147), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |