Danish

Uniprot ID: P02118

Protein: Hemoglobin subunit beta
Organism: Bar-headed goose (Anser indicus)
Length: 146
Sequence:

VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPDCQAAWQKLVRVVAHALARKYH

Number of chains: 8

PDB ID: 1a4f , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1a4f , Chain B-1
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	E-1
Available structure	PDB

PDB ID: 1c40 , Chain B
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1c40 , Chain B-1
Resolution	2.30 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	D-1
Available structure	PDB

PDB ID: 1hv4 , Chain B
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 1hv4 , Chain D
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 1hv4 , Chain F
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	F
label_asym_ids of heme	N
Available structure	PDB

PDB ID: 1hv4 , Chain H
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	H
label_asym_ids of heme	P
Available structure	PDB