Danish

Uniprot ID: P02208

Protein: Globin-5
Organism: Sea lamprey (Petromyzon marinus)
Length: 150
Sequence:

MPIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY

Number of chains: 25

PDB ID: 2lhb , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 3lhb , Chain A
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	M
Available structure	PDB

PDB ID: 3lhb , Chain B
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	B
label_asym_ids of heme	N
Available structure	PDB

PDB ID: 3lhb , Chain C
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	C
label_asym_ids of heme	O
Available structure	PDB

PDB ID: 3lhb , Chain D
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	D
label_asym_ids of heme	P
Available structure	PDB

PDB ID: 3lhb , Chain E
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	E
label_asym_ids of heme	Q
Available structure	PDB

PDB ID: 3lhb , Chain F
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	R
Available structure	PDB

PDB ID: 3lhb , Chain G
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	G
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 3lhb , Chain H
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	H
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 3lhb , Chain I
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	I
label_asym_ids of heme	U
Available structure	PDB

PDB ID: 3lhb , Chain J
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	J
label_asym_ids of heme	V
Available structure	PDB

PDB ID: 3lhb , Chain K
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	K
label_asym_ids of heme	W
Available structure	PDB

PDB ID: 3lhb , Chain L
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	L
label_asym_ids of heme	X
Available structure	PDB

PDB ID: 1f5o , Chain A
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1f5o , Chain B
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1f5o , Chain C
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 1f5o , Chain D
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	D
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 1f5o , Chain E
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	E
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 1f5o , Chain F
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	F
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 1f5p , Chain A
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1f5p , Chain B
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	B
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 1f5p , Chain C
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	C
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 1f5p , Chain D
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	D
label_asym_ids of heme	M
Available structure	PDB

PDB ID: 1f5p , Chain E
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	E
label_asym_ids of heme	O
Available structure	PDB

PDB ID: 1f5p , Chain F
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-149 (2-150), 0.99
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	F
label_asym_ids of heme	Q
Available structure	PDB