Danish
Uniprot ID:  P02208
  • Protein: Globin-5
  • Organism: Sea lamprey (Petromyzon marinus)
  • Length: 150
  • Sequence:
    • MPIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSAY
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  25
PDB ID:  pdb_00002lhb , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003lhb , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003lhb , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id B
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00003lhb , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id C
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00003lhb , Chain D 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id D
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00003lhb , Chain E 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00003lhb , Chain F 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id F
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003lhb , Chain G 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id G
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00003lhb , Chain H 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id H
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00003lhb , Chain I 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id I
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00003lhb , Chain J 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id J
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00003lhb , Chain K 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id K
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00003lhb , Chain L 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) Q64E, N83D, D101N, Q115E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9732
auth_asym_id L
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00001f5o , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001f5o , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001f5o , Chain C 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001f5o , Chain D 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001f5o , Chain E 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001f5o , Chain F 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00001f5p , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001f5p , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001f5p , Chain C 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001f5p , Chain D 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001f5p , Chain E 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00001f5p , Chain F 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 1-149 (2-150), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme Q
Available structure PDB