- Protein: Globin
- Organism: Sea hare (Aplysia limacina)
- Length: 147
- Sequence:
MSLSAAEADLAGKSWAPVFANKDANGDAFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDVSSRIFTRLNEFVNNAADAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-146), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-146), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-146), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.99 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| Difference from Uniprot sequence | conflict:engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-147), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-146), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (2-146), 0.99 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |