Danish

Uniprot ID: P02216

Protein: Globin, major monomeric component
Organism: Bloodworm (Glycera dibranchiata)
Length: 147
Sequence:

GLSAAQRQVIAATWKDIAGADNGAGVGKDCLIKFLSAHPQMAAVFGFSGASDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGNKHIKAQYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS

Number of chains: 4

PDB ID: 1jf3 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-147 (1-147), 1.00
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1jl7 , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-147 (1-147), 1.00
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1hbg , Chain A
Resolution	1.50 Å
Residue indices (Uniprot), coverage	1-147 (1-147), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2hbg , Chain A
Resolution	1.50 Å
Residue indices (Uniprot), coverage	1-147 (1-147), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB