Danish
Uniprot ID:  P02216
  • Protein: Globin, major monomeric component
  • Organism: Bloodworm (Glycera dibranchiata)
  • Length: 147
  • Sequence:
    • GLSAAQRQVIAATWKDIAGADNGAGVGKDCLIKFLSAHPQMAAVFGFSGASDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGNKHIKAQYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001jf3 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-147 (1-147), 1.00
Mutations (UniProt numbering) I10V, A12S, D29E, I32S, L35I, Q40E, A57E, Q82E, Q101E, A135G
Insertions None
Deletions None
Sequence identity to UniProt 0.9320
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001jl7 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-147 (1-147), 1.00
Mutations (UniProt numbering) I10V, A12S, D29E, I32S, L35I, Q40E, A57E, Q82E, Q101E, A135G
Insertions None
Deletions None
Sequence identity to UniProt 0.9320
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001hbg , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-147 (1-147), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D29K
Insertions None
Deletions None
Sequence identity to UniProt 0.9932
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002hbg , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-147 (1-147), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D29K
Insertions None
Deletions None
Sequence identity to UniProt 0.9932
auth_asym_id A
label_asym_ids of heme B
Available structure PDB