- Protein: Leghemoglobin 3
- Organism: Soybean (Glycine max)
- Length: 144
- Sequence:
MVAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-143 (2-144), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-143 (2-144), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-143 (2-144), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-143 (2-144), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |