Danish
Uniprot ID:  P02238
  • Protein: Leghemoglobin 3
  • Organism: Soybean (Glycine max)
  • Length: 144
  • Sequence:
    • MVAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001bin , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-143 (2-144), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001bin , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-143 (2-144), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001fsl , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-143 (2-144), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001fsl , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-143 (2-144), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB